rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

2.37 Rating by CuteStat

rahekaregarnews.com is 1 decade 3 years old. It is a domain having com extension. It has a global traffic rank of #1387314 in the world. This website is estimated worth of $ 480.00 and have a daily income of around $ 2.00. As no active threats were reported recently by users, rahekaregarnews.com is SAFE to browse.

PageSpeed Score
36
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 347
Daily Pageviews: 694

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,387,314
Domain Authority: 22 ON 100

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

Luke's Cafe 823 West Main St Abingdon, VA

- lukescafe.us

Luke's Cafe 823 West Main St Abingdon, VA 276-623-2233 | info@lukescafe.us

Not Applicable $ 8.95

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Mar 19, 2011, 12:00 AM 1 decade 3 years 1 month ago
Last Modified: Jan 8, 2012, 12:00 AM 1 decade 2 years 3 months ago
Expiration Date: Mar 19, 2014, 12:00 AM 1 decade 1 month 5 days ago

Domain Nameserver Information

Host IP Address Country
ns69.domaincontrol.com 97.74.104.45 United States of America United States of America
ns70.domaincontrol.com 173.201.72.45 United States of America United States of America

Similarly Ranked Websites

Image Converter Plus - Convert images, photos and graphics files in ba

- fcoder-icp.com

Convert and resize images easily

1,387,315 $ 480.00

АО "НЦПК"Өрлеу" ИПК ПР по Карагандинской области - Главная страница

- orleu-krg.kz

КАРАГАНДИНСКИЙ ФИЛИАЛ ИНСТИТУТ ПОВЫШЕНИЯ КВАЛИФИКАЦИИ, Өрлеу

1,387,317 $ 960.00


Rideau Auctions

- rideauauctions.com
1,387,319 $ 960.00

Cubizone | Your Ultimate Gaming Destination

- cubizone.com
1,387,323 $ 960.00